-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against B4GALT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against B4GALT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06956A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | B4GALT5 |
| Target Synonyms | gt-V; B4Gal-T5; beta4Gal-T5; beta4GalT-V; BETA4-GALT-IV; B4GALT5 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMP | Uniprot ID | O43286 |
Uniprot Id
O43286
Target Species
Human
Target Name
B4GALT5
Target Full Name
Beta-1,4-galactosyltransferase 5
Target Function
Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation. Plays a role in the glycosylation of BMPR1A and regulation of its protein stability. Essential for extraembryonic development during early embryogenesis.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Golgi apparatus.
Target Protein Families
Glycosyltransferase 7 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
4-galactosyltransferase 5; 4-GalT II; 4-GalTase 5; B4Gal T5; b4Gal-T5; B4galt5; B4GT5_HUMAN; Beta 1 4 galactosyltransferase 5; Beta 1 4 galactosyltransferase V; Beta 1 4 GalT II; Beta 1 4 GalT IV; Beta 1 4 GalTase 5; Beta-1; Beta-1,4-galactosyltransferase 5; Beta-1,4-GalT II; Beta-1,4-GalTase 5; Beta4 GALT IV; Beta4Gal T5; Beta4Gal-T5; Beta4GalT V; gt V; gtV; MGC138470; UDP Gal:beta GlcNAc beta 1 4 galactosyltransferase 5; UDP Gal:betaGlcNAc beta 1 4 galactosyltransferase 5; UDP Gal:betaGlcNAc beta 1 4 galactosyltransferase polypeptide 5; UDP galactose:beta N acetylglucosamine beta 1 4 galactosyltransferase 5; UDP-Gal:beta-GlcNAc beta-1; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
Target Background
This gene is one of seven beta-1, 4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1, 4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2.
Notification