-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCL2A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human BCL2A1 (NP_004040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BCL2A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human BCL2A1 (NP_004040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11516A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL2A1 |
| Target Synonyms | GRS; ACC1; ACC2; BFL1; ACC-1; ACC-2; HBPA1; BCL2L5; BCL2A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human BCL2A1 (NP_004040.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP | Uniprot ID | Q16548 |
Uniprot Id
Q16548
Target Species
Human
Target Name
BCL2A1
Target Full Name
Bcl-2-related protein A1
Target Function
Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection. Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and h
Target Research Area
Cell Biology
Target Synonyms
ACC 1; ACC 2 ; B2LA1_HUMAN; Bcl 2 related protein A1; Bcl-2-like protein 5; Bcl-2-related protein A1; BCL2 related protein A1; Bcl2-L-5; BCL2A1; BCL2L5 ; BFL1 ; GRS ; HBPA1 ; Hematopoietic BCL2 related protein A1 ; Hemopoietic specific early response protein; Hemopoietic-specific early response protein; Protein BFL 1; Protein BFL-1; Protein GRS
Target Background
This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification