Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-171 of human BTG1 (NP_001722.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BTG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-171 of human BTG1 (NP_001722.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of U2OS cells using BTG1 antibody.
| Cat.No | ADA-03070A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTG1 |
| Target Synonyms | APRO2; BTG1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-171 of human BTG1 (NP_001722.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG | Uniprot ID | P62324 |
Uniprot Id
P62324
Target Species
Human
Target Name
BTG1
Target Full Name
Protein BTG1
Target Function
Anti-proliferative protein.
Target Involvement
A chromosomal aberration involving BTG1 may be a cause of a form of B-cell chronic lymphocytic leukemia. Translocation t(8;12)(q24;q22) with MYC.
Target Protein Families
BTG family
Target Synonyms
BTG1Protein BTG1; B-cell translocation gene 1 protein
Target Background
This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
