-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-323 of human CACNG2 (NP_006069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CACNG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-323 of human CACNG2 (NP_006069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02976A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNG2 |
| Target Synonyms | MRD10; CACNG2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 204-323 of human CACNG2 (NP_006069.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV | Uniprot ID | Q9Y698 |
Uniprot Id
Q9Y698
Target Species
Human
Target Name
CACNG2
Target Full Name
Voltage-dependent calcium channel gamma-2 subunit
Target Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Target Involvement
Mental retardation, autosomal dominant 10 (MRD10)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Target Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Target Tissue Specificity
Brain.
Target Synonyms
CACNG2; Voltage-dependent calcium channel gamma-2 subunit; Neuronal voltage-gated calcium channel gamma-2 subunit; Transmembrane AMPAR regulatory protein gamma-2; TARP gamma-2
Target Background
The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. The AMPA subtype of ionotropic glutamate receptors are ligand gated ion channels that are typically activated by glutamate released from presynaptic neuron terminals and mediate fast neurotransmission in excitatory synapses. TARPs thus play an important role in synaptic plasticity, learning and memory. Mutations in this gene cause an autosomal dominant form of cognitive disability.
Notification