-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cardiac troponin T (TNNT2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cardiac troponin T (TNNT2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12085A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cardiac troponin T (TNNT2) |
| Target Synonyms | CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6; Cardiac troponin T (TNNT2) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL | Uniprot ID | P45379 |
Uniprot Id
P45379
Target Species
Human
Target Name
TNNT2
Target Full Name
Troponin T, cardiac muscle
Target Function
Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Target Involvement
Cardiomyopathy, familial hypertrophic 2 (CMH2); Cardiomyopathy, dilated 1D (CMD1D); Cardiomyopathy, familial restrictive 3 (RCM3)
Target Protein Families
Troponin T family
Target Tissue Specificity
Heart. The fetal heart shows a greater expression in the atrium than in the ventricle, while the adult heart shows a greater expression in the ventricle than in the atrium. Isoform 6 predominates in normal adult heart. Isoforms 1, 7 and 8 are expressed in
Target Synonyms
CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6; Cardiac troponin T (TNNT2)
Target Background
This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.
Notification