-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD320 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-229 of human CD320 (NP_057663.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD320 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-229 of human CD320 (NP_057663.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01146A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD320 |
| Target Synonyms | 8D6; 8D6A; TCBLR; TCN2R; TCII-R; sCD320; CD320 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 36-229 of human CD320 (NP_057663.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY | Uniprot ID | Q9NPF0 |
Uniprot Id
Q9NPF0
Target Species
Human
Target Name
CD320
Target Full Name
CD320 antigen
Target Function
Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10.
Target Involvement
Methylmalonic aciduria, transient, due to transcobalamin receptor defect (MMATC)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in the germinal center (GC) of lymphoid follicles (at protein level). Expressed abundantly on follicular dendritic cells (FDCs).
Target Research Area
Immunology
Target Synonyms
8D6; 8D6 antigen; 8D6A; CD320; CD320 antigen; CD320_HUMAN; FDC-signaling molecule 8D6; FDC-SM-8D6; TCblR; Transcobalamin receptor
Target Background
This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification