-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD66d/CEACAM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human CD66d/CEACAM3 (NP_001806.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD66d/CEACAM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human CD66d/CEACAM3 (NP_001806.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04324A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD66d/CEACAM3 |
| Target Synonyms | CEA; CGM1; W264; W282; CD66D; CD66d/CEACAM3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human CD66d/CEACAM3 (NP_001806.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEAT | Uniprot ID | P40198 |
Uniprot Id
P40198
Target Species
Human
Target Name
CEACAM3
Target Full Name
Cell adhesion molecule CEACAM3
Target Function
Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, CEA family
Target Tissue Specificity
CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intesti
Target Research Area
Immunology
Target Synonyms
carcinoembryonic ; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACAM 3; CEACAM-3; Ceacam3; CEAM 3; CEAM-3; CEAM3; CEAM3_HUMAN; CGM1; Nonspecific cross reacting antigen; W264; W282
Target Background
This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.
Notification