-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ch25h was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human Ch25h (NP_003947.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Ch25h was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human Ch25h (NP_003947.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08172A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CH25H |
| Target Synonyms | m25OH; Ch25h | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 171-270 of human Ch25h (NP_003947.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVP | Uniprot ID | O95992 |
Uniprot Id
O95992
Target Species
Human
Target Name
CH25H
Target Full Name
Cholesterol 25-hydroxylase
Target Function
Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes. Plays a key role in cell positioning and movement in lymphoid tissues: 25-hydroxycholesterol is an intermediate in biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC), an oxysterol that acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for a number of lymphoid cells. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. As an interferon-stimulated gene, has broad antiviral activities against a wide range of enveloped viruses, such as vesicular stomatitis virus (VSV) and SARS coronavirus-2 (SARS-CoV-2). Its product, 25-hydroxycholesterol, activates the ER-localized enzyme ACAT to induce internalization of accessible cholesterol on the plasma membrane and restricts SARS-CoV-2 S protein-mediated fusion which inhibits virus replication. In testis, production of 25-hydroxycholesterol by macrophages plays a role in Leydig cell differentiation.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Sterol desaturase family
Target Synonyms
CH25H; Cholesterol 25-hydroxylase; Cholesterol 25-monooxygenase; h25OH
Target Background
Enables cholesterol 25-hydroxylase activity. Involved in B cell chemotaxis. Acts upstream of or within cholesterol metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be integral component of membrane. Predicted to be active in endoplasmic reticulum membrane. Is expressed in several structures, including genitourinary system; gut; hemolymphoid system gland; respiratory system; and skin. Orthologous to human CH25H (cholesterol 25-hydroxylase).
Notification