-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CNGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04144A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNGA3 |
| Target Synonyms | CNG3; ACHM2; CCNC1; CCNCa; CNCG3; CCNCalpha; CNGA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, Mouse pancreas, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS | Uniprot ID | Q16281 |
Uniprot Id
Q16281
Target Species
Human
Target Name
CNGA3
Target Full Name
Cyclic nucleotide-gated channel alpha-3
Target Function
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones.
Target Involvement
Achromatopsia 2 (ACHM2)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA3 subfamily
Target Tissue Specificity
Prominently expressed in retina.
Target Synonyms
CNGA3; CNCG3; Cyclic nucleotide-gated cation channel alpha-3; Cone photoreceptor cGMP-gated channel subunit alpha; Cyclic nucleotide-gated channel alpha-3; CNG channel alpha-3; CNG-3; CNG3
Target Background
This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.
Notification