-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human COL5A1 (NP_000084.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human COL5A1 (NP_000084.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL5A1 |
| Target Synonyms | EDSC; FMDMF; EDSCL1; COL5A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Saos-2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human COL5A1 (NP_000084.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AKETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEGEENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDL | Uniprot ID | P20908 |
Uniprot Id
P20908
Target Species
Human
Target Name
COL5A1
Target Full Name
Collagen alpha-1(V) chain
Target Function
Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin.
Target Involvement
Ehlers-Danlos syndrome, classic type (EDS)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibrillar collagen family
Target Synonyms
AB collagen; Alpha 1 type V collagen; Alpha 2 type V collagen; CO5A1_HUMAN; COL5A1; Col5A2; COL5A2 protein; Col5A3; Collagen alpha 1(V) chain; Collagen alpha 2 (V) chain precursor; Collagen alpha 2(V) chain; Collagen alpha 3(V) chain; Collagen alpha-1(V) chain; Collagen fetal membrane A polypeptide; Collagen type V alpha 1; Collagen type V alpha 2; Collagen type V alpha 3; Collagen V alpha 2 polypeptide; CollagenV; MGC105115; OTTHUMP00000064637; Pro alpha 1 type V collagen; Pro alpha 3(V) collagen; Procollagen alpha 2(V); Type V preprocollagen alpha 2 chain
Target Background
This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. The encoded procollagen protein occurs commonly as the heterotrimer pro-alpha1(V)-pro-alpha1(V)-pro-alpha2(V). Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II. Alternative splicing of this gene results in multiple transcript variants.
Notification