-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human DCC (NP_005206.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human DCC (NP_005206.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00996A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCC |
| Target Synonyms | CRC18; CRCR1; MRMV1; HGPPS2; IGDCC1; NTN1R1; DCC | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human DCC (NP_005206.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLV | Uniprot ID | P43146 |
Uniprot Id
P43146
Target Species
Human
Target Name
DCC
Target Full Name
Netrin receptor DCC
Target Function
Receptor for netrin required for axon guidance. Mediates axon attraction of neuronal growth cones in the developing nervous system upon ligand binding. Its association with UNC5 proteins may trigger signaling for axon repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Implicated as a tumor suppressor gene.
Target Involvement
Mirror movements 1 (MRMV1); Gaze palsy, familial horizontal, with progressive scoliosis, 2 (HGPPS2)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, DCC family
Target Tissue Specificity
Found in axons of the central and peripheral nervous system and in differentiated cell types of the intestine. Not expressed in colorectal tumor cells that lost their capacity to differentiate into mucus producing cells.
Target Synonyms
Colorectal cancer related chromosome sequence 18; Colorectal cancer suppressor; CRC 18; CRC18; CRCR 1; CRCR1; DCC; DCC_HUMAN; Deleted in colorectal cancer protein; Deleted in colorectal carcinoma ; Immunoglobulin superfamily DCC subclass member 1; Netrin receptor DCC; Tumor suppressor protein DCC
Target Background
This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.
Notification