-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DGKA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DGKA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02805A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DGKA |
| Target Synonyms | DAGK; DAGK1; DGK-alpha; DGKA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Molt-4, SK-BR-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL | Uniprot ID | P23743 |
Uniprot Id
P23743
Target Species
Human
Target Name
DGKA
Target Full Name
Diacylglycerol kinase alpha
Target Function
Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes. Also plays an important role in the biosynthesis of complex lipids (Probable). Can also phosphorylate 1-alkyl-2-acylglycerol in vitro as efficiently as diacylglycerol provided it contains an arachidonoyl group. Also involved in the production of alkyl-lysophosphatidic acid, another bioactive lipid, through the phosphorylation of 1-alkyl-2-acetyl glycerol.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Eukaryotic diacylglycerol kinase family
Target Tissue Specificity
Expressed in lymphocytes.
Target Research Area
Signal Transduction
Target Synonyms
80 kDa diacylglycerol kinase; DAG kinase alpha; DAGK; DAGK1; DGK alpha; DGK-alpha; dgkA; DGKA_HUMAN; Diacylglycerol kinase alpha; Diacylglycerol kinase; alpha 80kDa; Diglyceride kinase alpha; MGC12821; MGC42356; OTTHUMP00000242836; OTTHUMP00000242955; OTTHUMP00000244046
Target Background
The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene.
Notification