Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EHBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EHBP1 (NP_056067.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EHBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EHBP1 (NP_056067.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01010A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EHBP1 |
| Target Synonyms | HPC12; NACSIN; EHBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Jurkat, LO2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EHBP1 (NP_056067.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTF | Uniprot ID | Q8NDI1 |
Uniprot Id
Q8NDI1
Target Species
Human
Target Name
EHBP1
Target Full Name
EH domain-binding protein 1
Target Function
May play a role in actin reorganization. Links clathrin-mediated endocytosis to the actin cytoskeleton. May act as Rab effector protein and play a role in vesicle trafficking. Required for perinuclear sorting and insulin-regulated recycling of SLC2A4/GLUT4 in adipocytes.
Target Involvement
Prostate cancer, hereditary, 12 (HPC12)
Target Subcellular Location
Cytoplasm. Membrane. Endosome. Note=Mostly found in cytosol and plasma membrane.
Target Synonyms
EHBP1; KIAA0903; NACSINEH domain-binding protein 1
Target Background
This gene encodes an Eps15 homology domain binding protein. The encoded protein may play a role in endocytic trafficking. A single nucleotide polymorphism in this gene is associated with an aggressive form of prostate cancer. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
