-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eNOS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 639-738 of human eNOS (NP_000594.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eNOS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 639-738 of human eNOS (NP_000594.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12661A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eNOS |
| Target Synonyms | eNOS; ECNOS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 639-738 of human eNOS (NP_000594.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLS | Uniprot ID | P29474 |
Uniprot Id
P29474
Target Species
Human
Target Name
NOS3
Target Full Name
Nitric oxide synthase 3
Target Function
Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.; Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.
Target Involvement
Variation Asp-298 in NOS3 may be associated with susceptibility to coronary spasm.
Target Subcellular Location
Cell membrane. Membrane, caveola. Cytoplasm, cytoskeleton. Golgi apparatus. Note=Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle; which is favored by interaction with NOSIP and results in a reduced enzymatic activity.
Target Protein Families
NOS family
Target Tissue Specificity
Platelets, placenta, liver and kidney.
Target Synonyms
cNOS; Constitutive NOS; EC NOS; EC-NOS; ecNOS; Endothelial nitric oxidase synthase ; Endothelial nitric oxide synthase ; Endothelial nitric oxide synthase 3; Endothelial NOS; eNOS; Nitric oxide synthase 3 (endothelial cell); Nitric oxide synthase 3; Nitric oxide synthase 3 endothelial cell; Nitric oxide synthase endothelial; Nitric oxide synthase; endothelial; NOS 3; NOS III; NOS type III; NOS3; NOS3_HUMAN; NOSIII
Target Background
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification