Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FDX1/ADX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human FDX1/ADX (NP_004100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FDX1/ADX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human FDX1/ADX (NP_004100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FDX1/ADX |
| Target Synonyms | ADX; FDX; LOH11CR1D; FDX1/ADX | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, DU145, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human FDX1/ADX (NP_004100.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS | Uniprot ID | P10109 |
Uniprot Id
P10109
Target Species
Human
Target Name
FDX1
Target Full Name
Adrenodoxin, mitochondrial
Target Function
Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Adrenodoxin/putidaredoxin family
Target Tissue Specificity
Highest levels in the adrenal gland (at protein level). Also detected in kidney and testis (at protein level).
Target Research Area
Metabolism
Target Synonyms
Adrenal ferredoxin; Adrenodoxin; Adrenodoxin; mitochondrial; ADX; ADX_HUMAN; FDX; fdx1; Ferredoxin 1; Ferredoxin-1; Hepatoredoxin; LOH11CR1D; Mitochondrial adrenodoxin; mitochondrial
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
