Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fibrinogen alpha chain (FGA) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-559 of human Fibrinogen alpha chain (FGA) (NP_000499.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Fibrinogen alpha chain (FGA) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-559 of human Fibrinogen alpha chain (FGA) (NP_000499.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fibrinogen alpha chain (FGA) |
| Target Synonyms | Fib2; Fibrinogen alpha chain (FGA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 410-559 of human Fibrinogen alpha chain (FGA) (NP_000499.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKE | Uniprot ID | P02671 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
