-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNA11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human GNA11 (NP_002058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GNA11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human GNA11 (NP_002058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04282A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNA11 |
| Target Synonyms | FBH; FBH2; FHH2; HG1K; HHC2; GNA-11; HYPOC2; GNA11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, BT-474, Mouse brain, Mouse intestine, Mouse lung, SKOV3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human GNA11 (NP_002058.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ | Uniprot ID | P29992 |
Uniprot Id
P29992
Target Species
Human
Target Name
GNA11
Target Full Name
Guanine nucleotide-binding protein subunit alpha-11
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C. Transduces FFAR4 signaling in response to long-chain fatty acids (LCFAs).
Target Involvement
Hypocalciuric hypercalcemia, familial 2 (HHC2); Hypocalcemia, autosomal dominant 2 (HYPOC2)
Target Subcellular Location
Cell membrane; Lipid-anchor. Cytoplasm. Note=In testicular cells, expressed exclusively in the cytoplasm.
Target Protein Families
G-alpha family, G(q) subfamily
Target Tissue Specificity
Expressed in testis.
Target Synonyms
G alpha-11; G-protein subunit alpha-11; GA11; GNA11; GNA11_HUMAN; guanine nucleotide binding protein (G protein); alpha 11 (Gq class); Guanine nucleotide-binding protein G(y) subunit alpha; Guanine nucleotide-binding protein subunit alpha-11; guanine nucleotide-binding protein; alpha 11; guanine nucleotide-binding protein; Gq class; GNA11
Target Background
The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.
Notification