-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HINT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HINT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00011A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HINT1 |
| Target Synonyms | HINT; NMAN; PKCI-1; PRKCNH1; HINT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 22Rv1, H460, K-562, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG | Uniprot ID | P49773 |
Uniprot Id
P49773
Target Species
Human
Target Name
HINT1
Target Full Name
Adenosine 5'-monophosphoramidase HINT1
Target Function
Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2. Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Hydrolyzes 3-indolepropionic acyl-adenylate, tryptamine adenosine phosphoramidate monoester and other fluorogenic purine nucleoside tryptamine phosphoramidates in vitro. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide. In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex. Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17. Deconjugates SUMO1 from RANGAP1.
Target Involvement
Neuromyotonia and axonal neuropathy, autosomal recessive (NMAN)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
HINT family
Target Tissue Specificity
Widely expressed.
Target Synonyms
Adenosine 5' monophosphoramidase; Adenosine 5''-monophosphoramidase; HINT 1; HINT1; HINT1_HUMAN; Histidine triad nucleotide binding protein 1; Histidine triad nucleotide-binding protein 1; PKCI 1; PKCI-1; PKCI1; PRKCNH1; Protein kinase C inhibitor 1; Protein kinase C interacting protein 1; Protein kinase C-interacting protein 1
Target Background
This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.
Notification