Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-140 of human HOXB2 (NP_002136.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-140 of human HOXB2 (NP_002136.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07385A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXB2 |
| Target Synonyms | K8; HOX2; HOX2H; Hox-2.8; HOXB2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-140 of human HOXB2 (NP_002136.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG | Uniprot ID | P14652 |
Uniprot Id
P14652
Target Species
Human
Target Name
HOXB2
Target Full Name
Homeobox protein Hox-B2
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family, Proboscipedia subfamily
Target Synonyms
homeo box 2H; homeo box B2; homeobox B2; Homeobox protein Hox-2.8; Homeobox protein Hox-2H; Homeobox protein Hox-B2; Hox 2 8 ; Hox 2H; HOX2 ; HOX2H ; hoxb2; HXB2_HUMAN; K8; K8 home protein
Target Background
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
