-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Human IgG3 was raised in Rabbit using the recombinant protein of human IgG3 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Human IgG3 was raised in Rabbit using the recombinant protein of human IgG3 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Human IgG3 |
| Target Synonyms | IgG3; Human IgG3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant IgG3 protein | Application | ELISA, WB |
| Immunogen Description | Recombinant protein of human IgG3. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC | Uniprot ID | P01860 |
Uniprot Id
P01860
Target Species
Human
Target Name
IGHG3
Target Full Name
Immunoglobulin heavy constant gamma 3
Target Function
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.
Target Subcellular Location
Secreted. Cell membrane.
Target Synonyms
IGHG3Immunoglobulin heavy constant gamma 3; HDC; Heavy chain disease protein; Ig gamma-3 chain C region
Target Background
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
Notification