Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human IL9 (NP_000581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IL9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human IL9 (NP_000581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded rat lung using IL9 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-09940A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL9 |
| Target Synonyms | P40; HP40; IL-9; IL9 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human IL9 (NP_000581.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI | Uniprot ID | P15248 |
Uniprot Id
P15248
Target Species
Human
Target Name
IL9
Target Full Name
Interleukin-9
Target Function
Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Target Subcellular Location
Secreted.
Target Protein Families
IL-7/IL-9 family
Target Research Area
Cancer
Target Synonyms
Cytokine P40; Homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; IL-9; Il9; IL9_HUMAN; Interleukin 9; Interleukin-9; Mast cell growth factor; MCGF; Megakaryoblast growth factor; P40; p40 cytokine; p40 T cell and mast cell growth factor ; T cell growth factor 3 ; T cell growth factor p40 ; T-cell growth factor P40; TCGF 3
Target Background
The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
