-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Inhibin alpha (INHA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Inhibin alpha (INHA) (NP_002182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Inhibin alpha (INHA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Inhibin alpha (INHA) (NP_002182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04523A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Inhibin alpha (INHA) |
| Target Synonyms | INHA; Inhibin alpha (INHA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary, SK-BR-3, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Inhibin alpha (INHA) (NP_002182.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP | Uniprot ID | P05111 |
Uniprot Id
P05111
Target Species
Human
Target Name
INHA
Target Full Name
Inhibin alpha chain
Target Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family
Target Tissue Specificity
Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal g
Target Synonyms
INHA; Inhibin alpha (INHA)
Target Background
This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Mutations in this gene may be associated with male infertility and premature ovarian failure in female human patients.
Notification