-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNMA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNMA1 (NP_001258447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNMA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNMA1 (NP_001258447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10114A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNMA1 |
| Target Synonyms | SLO; BKTM; SLO1; hSlo; IEG16; LIWAS; MaxiK; PNKD3; SAKCA; mSLO1; CADEDS; KCa1.1; SLO-ALPHA; bA205K10.1; KCNMA1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNMA1 (NP_001258447.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILT | Uniprot ID | Q12791 |
Uniprot Id
Q12791
Target Species
Human
Target Name
KCNMA1
Target Full Name
Calcium-activated potassium channel subunit alpha-1
Target Function
Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).
Target Involvement
Paroxysmal nonkinesigenic dyskinesia, 3, with or without generalized epilepsy (PNKD3)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Potassium channel family, Calcium-activated (TC 1.A.1.3) subfamily, KCa1.1/KCNMA1 sub-subfamily
Target Tissue Specificity
Widely expressed. Except in myocytes, it is almost ubiquitously expressed.
Target Research Area
Cancer
Target Synonyms
subfamily M subunit alpha-1; BK channel; BKCA alpha; BKCA alpha subunit; BKTM; Calcium-activated potassium channel; Calcium-activated potassium channel subunit alpha-1; Drosophila slowpoke like; hSlo; K(VCA)alpha; KCa1.1; KCMA1_HUMAN; KCNMA; KCNMA1; Maxi K channel; Maxi Potassium channel alpha ; MaxiK; SAKCA; SLO alpha; SLO; Slo homolog; Slo-alpha; Slo1; Slowpoke homolog
Target Background
This gene encodes the alpha subunit of calcium-activated BK channel. The encoded protein is involved in several physiological processes including smooth muscle contraction, neurotransmitter release and neuronal excitability. Mutations in this gene are associated with a spectrum of neurological disorders including Paroxysmal Nonkinesigenic Dyskinesia 3, Idiopathic Generalized Epilepsy 16 and Liang-Wang syndrome.
Notification