Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lysozyme (LYZ) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Lysozyme (LYZ) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10306A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lysozyme (LYZ) |
| Target Synonyms | LZM; LYZF1; Lysozyme (LYZ) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse lung, U-937 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS | Uniprot ID | P61626 |
Uniprot Id
P61626
Target Species
Human
Target Name
LYZ
Target Full Name
Lysozyme C
Target Function
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Target Involvement
Amyloidosis 8 (AMYL8)
Target Subcellular Location
Secreted.
Target Protein Families
Glycosyl hydrolase 22 family
Target Research Area
Tags & Cell Markers
Target Synonyms
1 4 beta N acetylmuramidase C; 1; 4-beta-N-acetylmuramidase C; EC 3.2.1.17; LYSC_HUMAN; Lysosyme; Lysozyme (renal amyloidosis); Lysozyme C; Lysozyme C precursor; LYZ; LZM; Renal amyloidosis
Target Background
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
