Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 269-353 of human MAFA (NP_963883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 269-353 of human MAFA (NP_963883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07352A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAFA |
| Target Synonyms | INSDM; hMafA; RIPE3b1; MAFA | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 269-353 of human MAFA (NP_963883.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTADFFL | Uniprot ID | Q8NHW3 |
Uniprot Id
Q8NHW3
Target Species
Human
Target Name
MAFA
Target Full Name
Transcription factor MafA
Target Function
Transcription factor that activates insulin gene expression. Acts synergistically with NEUROD1/BETA2 and PDX1. Binds the insulin enhancer C1/RIPE3b element. Binds to consensus TRE-type MARE 5'-TGCTGACTCAGCA-3' DNA sequence.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Maf subfamily
Target Tissue Specificity
Expressed in the islets of Langerhans (at protein level).
Target Synonyms
HMafA; Mafa; MAFA_HUMAN; Pancreatic beta cell specific transcriptional activator; Pancreatic beta-cell-specific transcriptional activator; RIPE3b1; Transcription factor MafA; Transcription factor RIPE3b1; v maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian); v maf musculoaponeurotic fibrosarcoma oncogene homolog A; V-maf musculoaponeurotic fibrosarcoma oncogene homolog A
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
