Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human MAP2 (NP_002365.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human MAP2 (NP_002365.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11954A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Map2 |
| Target Synonyms | MAP-2; MAP2A; MAP2B; MAP2C; MAP2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human MAP2 (NP_002365.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD | Uniprot ID | P11137 |
Uniprot Id
P11137
Target Species
Human
Target Name
MAP2
Target Full Name
Microtubule-associated protein 2
Target Function
The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, dendrite.
Target Synonyms
DKFZp686I2148; MAP 2; MAP dendrite specific; MAP-2; MAP2; MAP2A; MAP2B; MAP2C; Microtubule associated protein 2; Microtubule-associated protein 2; MTAP2_HUMAN
Target Background
This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
