Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MFF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MFF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11012A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MFF |
| Target Synonyms | EMPF2; GL004; C2orf33; MFF | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRN | Uniprot ID | Q9GZY8 |
Uniprot Id
Q9GZY8
Target Species
Human
Target Name
MFF
Target Full Name
Mitochondrial fission factor
Target Function
Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.
Target Involvement
Encephalopathy due to defective mitochondrial and peroxisomal fission 2 (EMPF2)
Target Subcellular Location
Mitochondrion outer membrane; Single-pass type IV membrane protein. Peroxisome. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.
Target Protein Families
Tango11 family
Target Tissue Specificity
Highly expressed in heart, kidney, liver, brain, muscle, and stomach.
Target Research Area
Others
Target Synonyms
C2orf33 ; Chromosome 2 open reading frame 33; DKFZp666J168; GL004 ; Mff; MFF_HUMAN; MGC110913; Mitochondrial fission factor; OTTHUMP00000164235
Target Background
This is a nuclear gene encoding a protein that functions in mitochondrial and peroxisomal fission. The encoded protein recruits dynamin-1-like protein (DNM1L) to mitochondria. There are multiple pseudogenes for this gene on chromosomes 1, 5, and X. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
