Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MLC1 (NP_055981.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MLC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MLC1 (NP_055981.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11140A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLC1 |
| Target Synonyms | VL; LVM; MLC; MLC1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MLC1 (NP_055981.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ | Uniprot ID | Q15049 |
Uniprot Id
Q15049
Target Species
Human
Target Name
MLC1
Target Full Name
Membrane protein MLC1
Target Function
Regulates the response of astrocytes to hypo-osmosis by promoting calcium influx.
Target Involvement
Leukoencephalopathy, megalencephalic, with subcortical cysts, 1 (MLC1)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane. Cytoplasm, perinuclear region. Endoplasmic reticulum.
Target Tissue Specificity
Expressed in the brain, with highest levels found in the amygdala, nucleus caudatus, thalamus and hippocampus.
Target Synonyms
KIAA0027; LVM; Megalencephalic leukoencephalopathy with subcortical cysts 1; Membrane protein MLC1; MLC; MLC1; MLC1_HUMAN; VL; WKL1
Target Background
The function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an autosomal recessive neurological disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
