-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLYCD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human MLYCD(NP_036345.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MLYCD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human MLYCD(NP_036345.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08500A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLYCD |
| Target Synonyms | MCD; MLYCD | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human MLYCD(NP_036345.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWF | Uniprot ID | O95822 |
Uniprot Id
O95822
Target Species
Human
Target Name
MLYCD
Target Full Name
Malonyl-CoA decarboxylase, mitochondrial
Target Function
Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
Target Involvement
Malonyl-CoA decarboxylase deficiency (MLYCD deficiency)
Target Subcellular Location
Cytoplasm. Mitochondrion matrix. Peroxisome. Peroxisome matrix.
Target Tissue Specificity
Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary and small intestine.
Target Research Area
others
Target Synonyms
DCMC_HUMAN; hMCD; Malonyl CoA decarboxylase; Malonyl CoA decarboxylase mitochondrial; Malonyl coenzyme A decarboxylase; Malonyl-CoA decarboxylase; MCD; MGC59795; mitochondrial; Mlycd
Target Background
The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded protein acts to increase the rate of fatty acid oxidation. It is found in mitochondria, peroxisomes, and the cytoplasm. Mutations in this gene result in malonyl-CoA decarboyxlase deficiency.
Notification