Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MRPS14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05011A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS14 |
| Target Synonyms | S14mt; COXPD38; MRP-S14; HSMRPS14; DJ262D12.2; MRPS14 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, BxPC-3, Mouse liver, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW | Uniprot ID | O60783 |
Uniprot Id
O60783
Target Species
Human
Target Name
MRPS14
Target Full Name
Small ribosomal subunit protein uS14m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uS14 family
Target Synonyms
MRPS14; 28S ribosomal protein S14; mitochondrial; MRP-S14; S14mt; Mitochondrial small ribosomal subunit protein uS14m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S14P family. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
