-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-ND5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human MT-ND5 (YP_003024036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MT-ND5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human MT-ND5 (YP_003024036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11564A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-ND5 |
| Target Synonyms | MTND5; ND5; MT-ND5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human MT-ND5 (YP_003024036.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL | Uniprot ID | P03915 |
Uniprot Id
P03915
Target Species
Human
Target Name
MT-ND5
Target Full Name
NADH-ubiquinone oxidoreductase chain 5
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
Target Involvement
Leber hereditary optic neuropathy (LHON); Leigh syndrome (LS); Mitochondrial complex I deficiency (MT-C1D); Mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Complex I subunit 5 family
Target Synonyms
Complex I, subunit ND5; EC 1.6.5.3; Mitochondrially encoded NADH dehydrogenase 5; MT ND5; MT-ND5; MTND 5; MTND5; NAD5; NADH dehydrogenase subunit 5 (complex I); NADH dehydrogenase subunit 5; NADH ubiquinone oxidoreductase , subunit ND5; NADH ubiquinone oxidoreductase chain 5; NADH-ubiquinone oxidoreductase chain 5; NADH5; ND5; NU5M_HUMAN
Target Background
Contributes to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Is expressed in central nervous system; heart; liver; metanephros; and retina. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and MELAS syndrome. Orthologous to human MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5).
Notification