Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYLK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYLK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of U2OS cells using MYLK3 Rabbit pAb. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-02899A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYLK3 |
| Target Synonyms | MLCK; MLCK2; caMLCK; MYLK3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGT | Uniprot ID | Q32MK0 |
Uniprot Id
Q32MK0
Target Species
Human
Target Name
MYLK3
Target Full Name
Myosin light chain kinase 3
Target Function
Kinase that phosphorylates MYL2 in vitro. Promotes sarcomere formation in cardiomyocytes and increases cardiomyocyte contractility.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Tissue Specificity
Restricted to heart.
Target Synonyms
caMLCK ; cardiac MLCK; Cardiac MyBP C associated Ca/CaM kinase ; Cardiac-MyBP-C-associated Ca/CaM kinase; MLC kinase ; MLCK ; MLCK2 ; Mylk3; MYLK3_HUMAN; Myosin light chain kinase 3; Putative myosin light chain kinase 3
Target Background
Phosphorylation of cardiac myosin heavy chains (see MYH7B, MIM 609928) and light chains (see MYL2, MIM 160781) by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes (Chan et al., 2008 [PubMed 18202317]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
