-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human NCR3 (NP_667341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human NCR3 (NP_667341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03023A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCR3 |
| Target Synonyms | 1C7; MALS; CD337; LY117; NKp30; NCR3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human NCR3 (NP_667341.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL | Uniprot ID | O14931 |
Uniprot Id
O14931
Target Species
Human
Target Name
NCR3
Target Full Name
Natural cytotoxicity triggering receptor 3
Target Function
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Natural cytotoxicity receptor (NCR) family
Target Tissue Specificity
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
Target Synonyms
NCR3; 1C7; LY117; Natural cytotoxicity triggering receptor 3; Activating natural killer receptor p30; Natural killer cell p30-related protein; NK-p30; NKp30; CD antigen CD337
Target Background
The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
Notification