Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NGDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NGDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05578A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NGDN |
| Target Synonyms | NGD; LCP5; CANu1; lpd-2; C14orf120; NGDN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, K-562, Mouse brain, Mouse spleen, Mouse testis, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL | Uniprot ID | Q8NEJ9 |
Uniprot Id
Q8NEJ9
Target Species
Human
Target Name
NGDN
Target Full Name
Neuroguidin
Target Function
Involved in the translational repression of cytoplasmic polyadenylation element (CPE)-containing mRNAs.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Chromosome, centromere. Cytoplasm. Cell projection, axon. Cell projection, dendrite. Cell projection, filopodium.
Target Protein Families
SAS10 family
Target Synonyms
NGDN; C14orf120; Neuroguidin; Centromere accumulated nuclear protein 1; CANu1; EIF4E-binding protein
Target Background
Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
