-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NHP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human NHP2 (NP_060308.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NHP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human NHP2 (NP_060308.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00404A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NHP2 |
| Target Synonyms | DKCB2; NHP2P; NOLA2; NHP2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human NHP2 (NP_060308.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL | Uniprot ID | Q9NX24 |
Uniprot Id
Q9NX24
Target Species
Human
Target Name
NHP2
Target Full Name
H/ACA ribonucleoprotein complex subunit 2
Target Function
Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
Target Involvement
Dyskeratosis congenita, autosomal recessive, 2 (DKCB2)
Target Subcellular Location
Nucleus, nucleolus. Nucleus, Cajal body. Note=Also localized to Cajal bodies (coiled bodies).
Target Protein Families
Eukaryotic ribosomal protein eL8 family
Target Tissue Specificity
Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver.
Target Synonyms
DKCB2; FLJ20479; H/ACA ribonucleoprotein complex subunit 2; NHP2; NHP2 like protein; NHP2 ribonucleoprotein; NHP2 ribonucleoprotein homolog (yeast) 1; NHP2 ribonucleoprotein homolog; NHP2; S. cerevisiae; homolog of; NHP2_HUMAN; NHP2P; NOLA2; Nucleolar protein family A member 2 (H/ACA small nucleolar RNPs); Nucleolar protein family A member 2; snoRNP protein NHP2
Target Background
This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nhp2p. Alternative splicing results in multiple transcript variants.
Notification