Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-704 of human NLN (NP_065777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-704 of human NLN (NP_065777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of HeLa, using NLN Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-03438A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLN |
| Target Synonyms | MEP; MOP; AGTBP; EP24.16; NLN | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 630-704 of human NLN (NP_065777.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP | Uniprot ID | Q9BYT8 |
Uniprot Id
Q9BYT8
Target Species
Human
Target Name
NLN
Target Full Name
Neurolysin, mitochondrial
Target Function
Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
Target Subcellular Location
Mitochondrion intermembrane space. Cytoplasm.
Target Protein Families
Peptidase M3 family
Target Synonyms
AGTBP; Angiotensin binding protein; Angiotensin-binding protein; DKFZp564F123; EC 3.4.24.16; EP24.16; FLJ23002; KIAA1226; MEP; Microsomal endopeptidase; mitochondrial; Mitochondrial oligopeptidase M; MOP; NEUL_HUMAN; neurolysin (metallopeptidase M3 family); Neurolysin; Neurolysin, mitochondrial precursor; Neurotensin endopeptidase; Nln
Target Background
This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
