-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OTX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-280 of human OTX2 (NP_068374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against OTX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-280 of human OTX2 (NP_068374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00682A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OTX2 |
| Target Synonyms | CPHD6; MCOPS5; OTX2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-280 of human OTX2 (NP_068374.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNA | Uniprot ID | P32243 |
Uniprot Id
P32243
Target Species
Human
Target Name
OTX2
Target Full Name
Homeobox protein OTX2
Target Function
Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Target Involvement
Microphthalmia, syndromic, 5 (MCOPS5); Pituitary hormone deficiency, combined, 6 (CPHD6); Retinal dystrophy, early-onset, with or without pituitary dysfunction (RDEOP)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family, Bicoid subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CPHD6; Homeobox protein OTX2; MCOPS 5; MCOPS5; MGC45000; Orthodenticle 2; Orthodenticle homeobox 2; Orthodenticle homolog 2 (Drosophila); Orthodenticle homolog 2; Orthodenticle2; Otx 2; otx2; OTX2_HUMAN
Target Background
This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Notification