Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RY8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 298-359 of human P2RY8 (NP_835230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P2RY8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 298-359 of human P2RY8 (NP_835230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07155A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RY8 |
| Target Synonyms | P2Y8; P2RY8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, Raji, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 298-359 of human P2RY8 (NP_835230.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | REFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF | Uniprot ID | Q86VZ1 |
Uniprot Id
Q86VZ1
Target Species
Human
Target Name
P2RY8
Target Full Name
S-geranylgeranyl-glutathione receptor P2RY8
Target Function
Probable receptor for purines coupled to G-proteins.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Barely detectable in normal blood leukocytes. Weaker expression was seen in heart, kidney and lung. Not detected in brain.
Target Synonyms
P2RY8; P2Y purinoceptor 8; P2Y8
Target Background
The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromosomes X and Y.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
