-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDGFR alpha was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 896-1059 of human PDGFR alpha (NP_006197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PDGFR alpha was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 896-1059 of human PDGFR alpha (NP_006197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12246A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDGFR alpha |
| Target Synonyms | CD140A; PDGFR2; PDGFR-2; PDGFR alpha | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 896-1059 of human PDGFR alpha (NP_006197.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF | Uniprot ID | P16234 |
Uniprot Id
P16234
Target Species
Human
Target Name
PDGFRA
Target Full Name
Platelet-derived growth factor receptor alpha
Target Function
Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development and cephalic closure during embryonic development. Required for normal development of the mucosa lining the gastrointestinal tract, and for recruitment of mesenchymal cells and normal development of intestinal villi. Plays a role in cell migration and chemotaxis in wound healing. Plays a role in platelet activation, secretion of agonists from platelet granules, and in thrombin-induced platelet aggregation. Binding of its cognate ligands - homodimeric PDGFA, homodimeric PDGFB, heterodimers formed by PDGFA and PDGFB or homodimeric PDGFC -leads to the activation of several signaling cascades; the response depends on the nature of the bound ligand and is modulated by the formation of heterodimers between PDGFRA and PDGFRB. Phosphorylates PIK3R1, PLCG1, and PTPN11. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, mobilization of cytosolic Ca(2+) and the activation of protein kinase C. Phosphorylates PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and thereby mediates activation of the AKT1 signaling pathway. Mediates activation of HRAS and of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3 and STAT5A and/or STAT5B. Receptor signaling is down-regulated by protein phosphatases that dephosphorylate the receptor and its down-stream effectors, and by rapid internalization of the activated receptor.
Target Involvement
Gastrointestinal stromal tumor (GIST)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, cilium. Golgi apparatus.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Target Tissue Specificity
Detected in platelets (at protein level). Widely expressed. Detected in brain, fibroblasts, smooth muscle, heart, and embryo. Expressed in primary and metastatic colon tumors and in normal colon tissue.
Target Synonyms
Alpha-type platelet-derived growth factor receptor; CD140 antigen-like family member A; CD140a; CD140a antigen; MGC74795; PDGF alpha chain; PDGF Receptor alpha; PDGF-R-alpha; PDGFR 2; PDGFR alpha; PDGFR2; PDGFRA; PDGFRA/BCR fusion; PGFRA_HUMAN; Platelet derived growth factor receptor 2; Platelet derived growth factor receptor alpha; Platelet derived growth factor receptor alpha polypeptide; Platelet derived growth factor receptor; Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein; RHEPDGFRA
Target Background
This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers.
Notification