-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PELO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PELO (NP_057030.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PELO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PELO (NP_057030.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03897A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PELO |
| Target Synonyms | CGI-17; PRO1770; PELO | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, LO2, Mouse liver, Mouse pancreas, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PELO (NP_057030.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFD | Uniprot ID | Q9BRX2 |
Uniprot Id
Q9BRX2
Target Species
Human
Target Name
PELO
Target Full Name
Protein pelota homolog
Target Function
Cotranslational quality control factor involved in the No-Go Decay (NGD) pathway. In the presence of ABCE1 and HBS1L, is required for 48S complex formation from 80S ribosomes and dissociation of vacant 80S ribosomes. Together with HBS1L and in presence of ABCE1, recognizes stalled ribosomes and promotes dissociation of elongation complexes assembled on non-stop mRNAs; this triggers endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and to degrade damaged mRNAs as part of the No-Go Decay (NGD) pathway. As part of the PINK1-regulated signaling, upon mitochondrial damage is recruited to the ribosome/mRNA-ribonucleoprotein complex associated to mitochondrial outer membrane thereby enabling the recruitment of autophagy receptors and induction of mitophagy.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Eukaryotic release factor 1 family, Pelota subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
CGI 17; CGI17; pelo; PELO_HUMAN; pelota (Drosophila) homolog ; pelota homolog ; PRO1770; Protein pelota homolog
Target Background
This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division.
Notification