-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHLDA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human PHLDA3 (NP_036528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHLDA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human PHLDA3 (NP_036528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03180A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHLDA3 |
| Target Synonyms | TIH1; PHLDA3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human PHLDA3 (NP_036528.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS | Uniprot ID | Q9Y5J5 |
Uniprot Id
Q9Y5J5
Target Species
Human
Target Name
PHLDA3
Target Full Name
Pleckstrin homology-like domain family A member 3
Target Function
p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
PHLDA3 family
Target Tissue Specificity
Widely expressed with lowest expression in liver and spleen.
Target Synonyms
PHLA3_HUMAN; PHLDA 3; phlda3; Pleckstrin homology like domain family A member 2; Pleckstrin homology like domain family A member 3; Pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1; TDAG51/Ipl homologue 1; TIH 1; TIH1
Target Background
Enables phosphatidylinositol phosphate binding activity and phosphatidylinositol-3, 4-bisphosphate binding activity. Involved in intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator; negative regulation of protein kinase B signaling; and positive regulation of apoptotic process. Located in plasma membrane.
Notification