-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIDD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PIDD (NP_665893.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIDD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PIDD (NP_665893.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08788A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIDD |
| Target Synonyms | LRDD; PIDD; MRT75 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, 293T, K-562, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PIDD (NP_665893.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQL | Uniprot ID | Q9HB75 |
Uniprot Id
Q9HB75
Target Species
Human
Target Name
PIDD1
Target Full Name
p53-induced death domain-containing protein 1
Target Function
Component of the DNA damage/stress response pathway that functions downstream of p53/TP53 and can either promote cell survival or apoptosis. Associated with CRADD and the CASP2 caspase, it forms the PIDDosome a complex that activates CASP2 and triggers apoptosis. Associated with IKBKG and RIPK1, it enhances sumoylation and ubiquitination of IKBKG which is important for activation of the transcription factor NF-kappa-B.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
PIDD1; LRDD; PIDD; p53-induced death domain-containing protein 1; EC 3.4.21.-; Leucine-rich repeat and death domain-containing protein) [Cleaved into: PIDD-N; PIDD-C; PIDD-CC]
Target Background
The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Alternative splicing results in multiple transcript variants.
Notification