Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTCD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-537 of human PTCD1 (NP_056360.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PTCD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-537 of human PTCD1 (NP_056360.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11343A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTCD1 |
| Target Synonyms | PTCD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, OVCAR3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 435-537 of human PTCD1 (NP_056360.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE | Uniprot ID | O75127 |
Uniprot Id
O75127
Target Species
Human
Target Name
PTCD1
Target Full Name
Pentatricopeptide repeat-containing protein 1, mitochondrial
Target Function
Mitochondrial protein implicated in negative regulation of leucine tRNA levels, as well as negative regulation of mitochondria-encoded proteins and COX activity. Affects also the 3'-processing of mitochondrial tRNAs.
Target Subcellular Location
Mitochondrion. Mitochondrion matrix.
Target Protein Families
PTCD1 family
Target Tissue Specificity
Abundant in testes, skeletal muscle and heart.
Target Synonyms
Pentatricopeptide repeat containing protein 1; Pentatricopeptide repeat domain 1; Pentatricopeptide repeat-containing protein 1; PTCD1; PTCD1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
