-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PTPN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12612A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPN1 |
| Target Synonyms | PTP1B; PTPN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse brain, SKOV3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 281-435 of human PTPN1 (NP_002818.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT | Uniprot ID | P18031 |
Uniprot Id
P18031
Target Species
Human
Target Name
PTPN1
Target Full Name
Tyrosine-protein phosphatase non-receptor type 1
Target Function
Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Note=Interacts with EPHA3 at the cell membrane.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class 1 subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
TP1B; Non receptor tyrosine phosphatase 1; Protein phosphotyrosylphosphatase 1B; Protein tyrosine phosphatase 1B; Protein tyrosine phosphatase non receptor type 1; Protein tyrosine phosphatase placental; Protein-tyrosine phosphatase 1B; PTN1_HUMAN; PTP 1B; PTP-1B; PTPN 1; PTPN1; Tyrosine protein phosphatase non receptor type 1; Tyrosine-protein phosphatase non-receptor type 1
Target Background
The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. Two transcript variants encoding different isoforms have been found for this gene.
Notification