-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RGS4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGS4 (NP_005604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RGS4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGS4 (NP_005604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00296A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RGS4 |
| Target Synonyms | RGP4; SCZD9; RGS4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RGS4 (NP_005604.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKK | Uniprot ID | P49798 |
Uniprot Id
P49798
Target Species
Human
Target Name
RGS4
Target Full Name
Regulator of G-protein signaling 4
Target Function
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein.
Target Involvement
Schizophrenia (SCZD)
Target Tissue Specificity
Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum.
Target Synonyms
MGC2124; MGC60244; Regulator of G protein signalling 4; Regulator of G-protein signaling 4; RGP 4; RGP4; RGS 4; RGS4; RGS4_HUMAN; Schizophrenia disorder 9; SCZD 9; SCZD9
Target Background
Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene.
Notification