-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RLIM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-624 of human RLIM (NP_057204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RLIM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-624 of human RLIM (NP_057204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04797A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RLIM |
| Target Synonyms | MRX61; RNF12; TOKAS; NY-REN-43; RLIM | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 535-624 of human RLIM (NP_057204.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRESVV | Uniprot ID | Q9NVW2 |
Uniprot Id
Q9NVW2
Target Species
Human
Target Name
RLIM
Target Full Name
E3 ubiquitin-protein ligase RLIM
Target Function
E3 ubiquitin-protein ligase. Acts as a negative coregulator for LIM homeodomain transcription factors by mediating the ubiquitination and subsequent degradation of LIM cofactors LDB1 and LDB2 and by mediating the recruitment the SIN3a/histone deacetylase corepressor complex. Ubiquitination and degradation of LIM cofactors LDB1 and LDB2 allows DNA-bound LIM homeodomain transcription factors to interact with other protein partners such as RLIM. Plays a role in telomere length-mediated growth suppression by mediating the ubiquitination and degradation of TERF1. By targeting ZFP42 for degradation, acts as an activator of random inactivation of X chromosome in the embryo, a stochastic process in which one X chromosome is inactivated to minimize sex-related dosage differences of X-encoded genes in somatic cells of female placental mammals.
Target Involvement
Mental retardation, X-linked 61 (MRX61)
Target Subcellular Location
Nucleus.
Target Protein Families
RNF12 family
Target Tissue Specificity
Expressed in many tissues.
Target Synonyms
E3 ubiquitin-protein ligase RLIM; LIM domain-interacting RING finger protein; R-LIM; Renal carcinoma antigen NY-REN-43; RING finger LIM domain-binding protein; RING finger protein 12; RLIM; RNF12; RNF12_HUMAN
Target Background
The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification