Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF181 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human RNF181 (NP_057578.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF181 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human RNF181 (NP_057578.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00653A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF181 |
| Target Synonyms | HSPC238; RNF181 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, LO2, Mouse brain, Mouse liver, Mouse lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human RNF181 (NP_057578.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT | Uniprot ID | Q9P0P0 |
Uniprot Id
Q9P0P0
Target Species
Human
Target Name
RNF181
Target Full Name
E3 ubiquitin-protein ligase RNF181
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Target Protein Families
RNF181 family
Target Tissue Specificity
Widely expressed, with highest levels in liver and heart and lowest levels in brain and skeletal muscle. Expressed in platelets (at protein level).
Target Synonyms
RNF181; HSPC238; E3 ubiquitin-protein ligase RNF181; EC 2.3.2.27; RING finger protein 181; RING-type E3 ubiquitin transferase RNF181
Target Background
RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
