Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SDHD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SDHD (NP_002993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SDHD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SDHD (NP_002993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00341A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SDHD |
| Target Synonyms | PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4; MC2DN3; SDHD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SDHD (NP_002993.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGIC | Uniprot ID | O14521 |
Uniprot Id
O14521
Target Species
Human
Target Name
SDHD
Target Full Name
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
Target Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Target Involvement
Paragangliomas 1 (PGL1); Pheochromocytoma (PCC); Intestinal carcinoid tumor (ICT); Paraganglioma and gastric stromal sarcoma (PGGSS); Cowden syndrome 3 (CWS3); Mitochondrial complex II deficiency (MT-C2D)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
CybS family
Target Synonyms
SDHD; SDH4; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
