Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human Septin 1 (NP_443070.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Septin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human Septin 1 (NP_443070.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10495A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 1 |
| Target Synonyms | LARP; SEP1; DIFF6; SEPT1; PNUTL3; Septin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Jurkat, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human Septin 1 (NP_443070.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPM | Uniprot ID | Q8WYJ6 |
Uniprot Id
Q8WYJ6
Target Species
Human
Target Name
SEPT1
Target Full Name
Septin-1
Target Function
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential).
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody. Note=Remains at the centrosomes and the nearby microtubules throughout mitosis. Localizes to the midbody during cytokinesis.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Expressed at high levels in lymphoid and hematopoietic tissues.
Target Synonyms
DIFF6; Differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase); LARP; MGC20394; Peanut like protein 3; Peanut-like protein 3; PNUTL3; SEP1; SEPT1; SEPT1_HUMAN; Septin 1; Septin-1; Serologically defined breast cancer antigen NY BR 24; Serologically defined breast cancer antigen NY-BR-24
Target Background
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
