-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Serotonin transporter was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 520-620 of human Serotonin transporter (NP_001036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Serotonin transporter was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 520-620 of human Serotonin transporter (NP_001036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05458A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Serotonin transporter |
| Target Synonyms | HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR; Serotonin transporter | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 520-620 of human Serotonin transporter (NP_001036.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEI | Uniprot ID | P31645 |
Uniprot Id
P31645
Target Species
Human
Target Name
SLC6A4
Target Full Name
Sodium-dependent serotonin transporter
Target Function
Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endomembrane system; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Cell junction, synapse. Cell junction, focal adhesion.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A4 subfamily
Target Tissue Specificity
Expressed in platelets (at protein level).
Target Synonyms
5 HTT; 5 HTTLPR; 5 hydroxytryptamine (serotonin) transporter; 5 hydroxytryptamine transporter; 5HT transporter; 5HTT; hSERT; HTT; Na+/Cl- dependent serotonin transporter; OCD1; SC6A4_HUMAN; Serotonin transporter 1; SERT; SERT1; Slc6a4; Sodium dependent serotonin transporter; Sodium-dependent serotonin transporter; Solute carrier family 6 (neurotransmitter transporter) member 4; solute carrier family 6 (neurotransmitter transporter; serotonin); member 4; Solute carrier family 6 member 4
Target Background
This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression.
Notification